PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P09410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 418aa    MW: 46107.8 Da    PI: 10.1101
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P09410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.8e-092933301954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  GSMUA_Achr10P09410_001 293 FEHflHPYPKDSDKLMLAKQTGLTRSQVSNWFINARVR 330
                             664459******************************88 PP

2BELL124.15.3e-40160231172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             erqelq+kkakL+++leeV++rY+qy++q+q+v+ssFeavag+gsa+ Yt+lAl++iS++FrcL+dai+ qi
  GSMUA_Achr10P09410_001 160 ERQELQMKKAKLINMLEEVEQRYRQYHHQMQIVVSSFEAVAGYGSARTYTALALRTISKQFRCLRDAITAQI 231
                             79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-6286229IPR006563POX domain
PfamPF075263.3E-4992228IPR006563POX domain
PROSITE profilePS5007112.228271334IPR001356Homeobox domain
CDDcd000865.19E-11274335No hitNo description
SMARTSM003892.7E-9274338IPR001356Homeobox domain
SuperFamilySSF466893.25E-17275340IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28277340IPR009057Homeodomain-like
PfamPF059203.3E-18291330IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MATYFHGAPE IQPDGLQTLY LMNPSYACSP APITTFGRRR HRATRWTWRR NSMVAPAQEI  60
TPASAANEVK IAASASMASG AANGGSGLQS FLMGTKYLKA AQQLLDEVVN VGKGVKDEAA  120
KGAPLKNPAD SSNVELKDPG AGTSEGNTSA KRGADLTTAE RQELQMKKAK LINMLEEVEQ  180
RYRQYHHQMQ IVVSSFEAVA GYGSARTYTA LALRTISKQF RCLRDAITAQ IRETSKSLGE  240
EDSKSGGSRL RFIDHHLRQQ RALQQLGMIQ QNAWRPQRGL PERSVSILRA WLFEHFLHPY  300
PKDSDKLMLA KQTGLTRSQV SNWFINARVR LWKPMVEEMY LEELKDQEQN NSEENASNGD  360
ANGSSTSKSN AQQEGSPTGT APSESLKIDP NQTLAAVQPS SFAHGQSPAR TRRTTKTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16280338563Homeobox protein Meis2
3k2a_B1e-16280338563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420594.10.0PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-113BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM0RGR70.0M0RGR7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P09410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-102BEL1-like homeodomain 1